DESCRIPTION

Immunogen

Synthetic peptide directed towards the middle region of human ZXDC

Application

Anti-ZXDC antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

ZXD family zinc finger C (ZXDC; ZXDL) belongs to a family of transcription factors that are involved in regulation of major histocompatibility complex class II genes. ZXDC regulates genes involved in myeloid cell differentiation and CCL2 expression that is involved in inflammation responses.
Paraffin Wax Dispenser
Paraffin wax, granular (56 - 60)
Paraffin wax, granular (56 - 60)
Paraffin wax, granular (56 - 60)
Paraffin wax, granular (56 - 60)
8KG Histoplast PE Paraffin
Paraffin oil, BP, Ph. Eur. grade
Paraffin oil, BP, Ph. Eur. grade
Paraffin oil, BP, Ph. Eur. grade
Paraffin oil, BP, Ph. Eur. grade

Sequence

Synthetic peptide located within the following region: NLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
MULTIPLEX KIT PCR MASTITIS PCR kit
PCR-MPX218-48D Bioingentech
MULTIPLEX KIT PCR MASTITIS PCR kit
PCR-MPX218-96D Bioingentech
MULTIPLEX KIT PCR Babesia & Theileria PCR kit
PCR-MPX401-48D Bioingentech
MULTIPLEX KIT PCR Babesia & Theileria PCR kit
PCR-MPX401-96D Bioingentech
Leaf PCR Kit
11140007-1 Glycomatrix

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Product Info Tested Species ReactivityHuman Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. ClonalityPolyclonal HostRabbit ApplicationWB Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ZXDC PurificationAffinity Purified Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% Complete computational species homology dataAnti-ZXDC (ARP50448_P050) Peptide SequenceSynthetic peptide located within the following region: NLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPG Concentration0.5 mg/ml Blocking PeptideFor anti-ZXDC (ARP50448_P050) antibody is Catalog # AAP50448 (Previous Catalog # AAPP29744) ReferenceJambunathan,S. (2007) Biol. Chem. 388 (9), 965-972.
Target Info
Gene Symbol ZXDC
Gene Full Name ZXD family zinc finger C
Alias Symbols ZXDL
NCBI Gene Id 79364
Protein Name Zinc finger protein ZXDC
Description of Target ZXDC belongs to the ZXD family. It contains 10 C2H2-type zinc fingers. ZXDC cooperates with CIITA to promote transcription of MHC class I and MHC class II genes.
Swissprot Id Q2QGD7
Protein Accession # NP_001035743
Nucleotide Accession # NM_001040653
Protein Size (# AA) 710
Molecular Weight 75kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ZXDC. 
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ZXDC. 
Protein Interactions POGZ; WDR5; ATXN1; APP; JTB; TK1; SMN1; SH3GL2; NR1H3; NR1H2; RORA; CIITA;
Protocols & Data
Protocol:
  • Reconstitution & Storage Instructions
  • Western Blotting/Immunoblotting (WB/IB) Protocol
  • Immunohistochemistry (IHC) Protocol
  • Immunocytochemistry (ICC) Protocol
  • Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
  • Blocking Peptide Competition Protocol (BPCP)
  • Immunoprecipitation (IP) Protocol
  • Antibody Array (AA) Protocol
Tips Information:
  • IHC Tips & Tricks
  • ICC Tips & Tricks
  • ELISA Tips & Tricks
  • WB/IB Tips & Tricks
  • IP Tips & Tricks

See our General FAQ page.

Related Categories
ZXDC Antibody
ZXDC Antibody
Product FAQ
  1. What is the species homology for “ZXDC Antibody – middle region (ARP50448_P050)”?The tested species reactivity for this item is “Human”. This antibody is predicted to have homology to “Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish”.
  2. How long will it take to receive “ZXDC Antibody – middle region (ARP50448_P050)”?This item is available “Domestic: within 1-2 days delivery | International: 1-2 days”.
  3. What buffer format is “ZXDC Antibody – middle region (ARP50448_P050)” provided in?This item is provided in “Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.”.
    Additional format options may be available. For more information please contact [email protected].
  4. What are other names for “ZXDC Antibody – middle region (ARP50448_P050)”?This target may also be called “ZXDL” in publications.
  5. What is the shipping cost for “ZXDC Antibody – middle region (ARP50448_P050)”?The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
  6. What is the guarantee for “ZXDC Antibody – middle region (ARP50448_P050)”?All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
  7. Can I get bulk pricing for “ZXDC Antibody – middle region (ARP50448_P050)”?You can get bulk pricing for this item by going here.
  8. What is the molecular weight of the protein?The molecular weight reported by Uniprot for this item is “75kDa”.
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
  9. What protocols are available for “ZXDC Antibody – middle region (ARP50448_P050)”?We may have detailed protocol data avaialble for this item. To learn more, please view the “Protocols & Data” tab on the product page.
  10. What are positive controls for “ZXDC”?We have listed RNA Seq and gene expression data in the “Target Info” tab. You may be able to find adequate positive controls there.
  11. What are negative controls for “ZXDC”?We have listed RNA Seq and gene expression data in the “Target Info” tab. You may be able to find adequate positive controls there.
  12. What other proteins interact with “ZXDC”?This protein has been reported to interact with “Protein Interactions”. Please view the “Related Categories” tab on the product page for more information.
  13. What biological processes are associated with “ZXDC”?This protein has been associated with “Biological Processes”. Please view the “Related Categories” tab on the product page for more information.
  14. What cellular components are associated with “ZXDC”?This protein has been associated with “Cellular Components”. Please view the “Related Categories” tab on the product page for more information.
  15. What protein functions are associated with “ZXDC”?This protein has been associated with “Protein Functions”. Please view the “Related Categories” tab on the product page for more information.
Applications
  • ELISA
  • Applications tested for the base form of this product only
Paraffin Wax Dispenser
Paraffin wax, granular (56 - 60)
Paraffin wax, granular (56 - 60)
Paraffin wax, granular (56 - 60)
Paraffin wax, granular (56 - 60)
8KG Histoplast PE Paraffin
Paraffin oil, BP, Ph. Eur. grade
Paraffin oil, BP, Ph. Eur. grade
Paraffin oil, BP, Ph. Eur. grade
Paraffin oil, BP, Ph. Eur. grade
Usage
The applications listed above are for the unconjugated form of this antibody. The conjugated antibody has not been tested. The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.
Presentation
PBS, pH 7.4, 0.03% Proclin 300, 50% glycerol.
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Paraffin Wax Dispenser
HIS7000
Paraffin wax, granular (56 - 60)
GL4115-1KG
Paraffin wax, granular (56 - 60)
GL4115-5KG
Paraffin wax, granular (56 - 60)
GL4115-1
Paraffin wax, granular (56 - 60)
GL4115-5

LEAVE A REPLY

Please enter your comment!
Please enter your name here