DESCRIPTION

Immunogen

Synthetic peptide directed towards the middle region of human ZXDC

Application

Anti-ZXDC antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

ZXD family zinc finger C (ZXDC; ZXDL) belongs to a family of transcription factors that are involved in regulation of major histocompatibility complex class II genes. ZXDC regulates genes involved in myeloid cell differentiation and CCL2 expression that is involved in inflammation responses.
Paraffin Wax Dispenser
Paraffin wax, granular (56 - 60)
Paraffin wax, granular (56 - 60)
MagSi-WAX
MagSi-WAX
MagSi-WAX
Wax Paper For Se235 Pkg100
neo WAX 30mg Plate SPE Columns
neo WAX 100mg/3mL SPE Columns
neo WAX 200mg/6mL SPE Columns

Sequence

Synthetic peptide located within the following region: NLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
PCR Mycoplasma Detection Kit
M034-Kit TOKU-E
MULTIPLEX KIT PCR MASTITIS PCR kit
PCR-MPX218-48D Bioingentech
MULTIPLEX KIT PCR MASTITIS PCR kit
PCR-MPX218-96D Bioingentech
MULTIPLEX KIT PCR Babesia & Theileria PCR kit
PCR-MPX401-48D Bioingentech
MULTIPLEX KIT PCR Babesia & Theileria PCR kit
PCR-MPX401-96D Bioingentech

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Product Info Tested Species ReactivityHuman Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. ClonalityPolyclonal HostRabbit ApplicationWB Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ZXDC PurificationAffinity Purified Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% Complete computational species homology dataAnti-ZXDC (ARP50448_P050) Peptide SequenceSynthetic peptide located within the following region: NLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPG Concentration0.5 mg/ml Blocking PeptideFor anti-ZXDC (ARP50448_P050) antibody is Catalog # AAP50448 (Previous Catalog # AAPP29744) ReferenceJambunathan,S. (2007) Biol. Chem. 388 (9), 965-972.
Target Info
Gene Symbol ZXDC
Gene Full Name ZXD family zinc finger C
Alias Symbols ZXDL
NCBI Gene Id 79364
Protein Name Zinc finger protein ZXDC
Description of Target ZXDC belongs to the ZXD family. It contains 10 C2H2-type zinc fingers. ZXDC cooperates with CIITA to promote transcription of MHC class I and MHC class II genes.
Swissprot Id Q2QGD7
Protein Accession # NP_001035743
Nucleotide Accession # NM_001040653
Protein Size (# AA) 710
Molecular Weight 75kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ZXDC. 
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ZXDC. 
Protein Interactions POGZ; WDR5; ATXN1; APP; JTB; TK1; SMN1; SH3GL2; NR1H3; NR1H2; RORA; CIITA;
Protocols & Data
Protocol:
  • Reconstitution & Storage Instructions
  • Western Blotting/Immunoblotting (WB/IB) Protocol
  • Immunohistochemistry (IHC) Protocol
  • Immunocytochemistry (ICC) Protocol
  • Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
  • Blocking Peptide Competition Protocol (BPCP)
  • Immunoprecipitation (IP) Protocol
  • Antibody Array (AA) Protocol
Tips Information:
  • IHC Tips & Tricks
  • ICC Tips & Tricks
  • ELISA Tips & Tricks
  • WB/IB Tips & Tricks
  • IP Tips & Tricks

See our General FAQ page.

Related Categories
Protein interactions
Name # of Products
CIITA 27
JTB 2
NR1H2 93
NR1H3 71
RORA 51
SH3GL2 130
SMN1 388
TK1 389
Biological pathways
Name # of Products
Positive regulation of transcription, DNA-dependent 694
Transcription, DNA-dependent 3394
Biological process
Name # of Products
Positive regulation of transcription, DNA-dependent 681
Cellular components
Name # of Products
Cellular_component 556
Intracellular 1678
Nucleus 4914
Protein function
Name # of Products
C2H2 zinc finger domain binding 39
LRR domain binding 12
Metal ion binding 5514
Nucleic acid binding 617
Protein binding 12191
Sequence-specific DNA binding transcription factor activity 2776
Zinc ion binding 3721
ZXDC Antibody
ZXDC Antibody
Product FAQ
  1. What is the species homology for “ZXDC Antibody – middle region (ARP50448_P050)”?The tested species reactivity for this item is “Human”. This antibody is predicted to have homology to “Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish”.
  2. How long will it take to receive “ZXDC Antibody – middle region (ARP50448_P050)”?This item is available “Domestic: within 1-2 days delivery | International: 1-2 days”.
  3. What buffer format is “ZXDC Antibody – middle region (ARP50448_P050)” provided in?This item is provided in “Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.”.
    Additional format options may be available. For more information please contact [email protected].
  4. What are other names for “ZXDC Antibody – middle region (ARP50448_P050)”?This target may also be called “ZXDL” in publications.
  5. What is the shipping cost for “ZXDC Antibody – middle region (ARP50448_P050)”?The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
  6. What is the guarantee for “ZXDC Antibody – middle region (ARP50448_P050)”?All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
  7. Can I get bulk pricing for “ZXDC Antibody – middle region (ARP50448_P050)”?You can get bulk pricing for this item by going here.
  8. What is the molecular weight of the protein?The molecular weight reported by Uniprot for this item is “75kDa”.
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
  9. What protocols are available for “ZXDC Antibody – middle region (ARP50448_P050)”?We may have detailed protocol data avaialble for this item. To learn more, please view the “Protocols & Data” tab on the product page.
  10. What are positive controls for “ZXDC”?We have listed RNA Seq and gene expression data in the “Target Info” tab. You may be able to find adequate positive controls there.
  11. What are negative controls for “ZXDC”?We have listed RNA Seq and gene expression data in the “Target Info” tab. You may be able to find adequate positive controls there.
  12. What other proteins interact with “ZXDC”?This protein has been reported to interact with “Protein Interactions”. Please view the “Related Categories” tab on the product page for more information.
  13. What biological processes are associated with “ZXDC”?This protein has been associated with “Biological Processes”. Please view the “Related Categories” tab on the product page for more information.
  14. What cellular components are associated with “ZXDC”?This protein has been associated with “Cellular Components”. Please view the “Related Categories” tab on the product page for more information.
  15. What protein functions are associated with “ZXDC”?This protein has been associated with “Protein Functions”. Please view the “Related Categories” tab on the product page for more information.
Applications
  • ELISA
  • Applications tested for the base form of this product only
Paraffin Wax Dispenser
Paraffin wax, granular (56 - 60)
Paraffin wax, granular (56 - 60)
MagSi-WAX
MagSi-WAX
MagSi-WAX
Wax Paper For Se235 Pkg100
neo WAX 30mg Plate SPE Columns
neo WAX 100mg/3mL SPE Columns
neo WAX 200mg/6mL SPE Columns
Usage
The applications listed above are for the unconjugated form of this antibody. The conjugated antibody has not been tested. The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.
Presentation
PBS, pH 7.4, 0.03% Proclin 300, 50% glycerol.
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.

ZXDC antibody
70R-21424 Fitzgerald 50 ul 522 EUR

ZXDC siRNA
20-abx941262 Abbexa
  • 661.20 EUR
  • 878.40 EUR
  • 15 nmol
  • 30 nmol

ZXDC siRNA
20-abx941263 Abbexa
  • 661.20 EUR
  • 878.40 EUR
  • 15 nmol
  • 30 nmol

ZXDC antibody
70R-8902 Fitzgerald 50 ug 560.4 EUR

ZXDC Antibody
1-CSB-PA648494LA01HU Cusabio
  • 380.40 EUR
  • 402.00 EUR
  • 100ug
  • 50ug

ZXDC Antibody
1-CSB-PA027161GA01HU Cusabio
  • 716.40 EUR
  • 399.60 EUR
  • 150ul
  • 50ul

Human Zinc finger protein ZXDC, ZXDC ELISA KIT
ELI-17653h Lifescience Market 96 Tests 988.8 EUR

Mouse Zinc finger protein ZXDC, Zxdc ELISA KIT
ELI-17840m Lifescience Market 96 Tests 1038 EUR

ZXDC Blocking Peptide
33R-6761 Fitzgerald 100 ug 216 EUR

ZXDC cloning plasmid
CSB-CL648494HU-10ug Cusabio 10ug 279.6 EUR

Anti-ZXDC antibody
PAab09763 Lifescience Market 100 ug 494.4 EUR

anti- ZXDC antibody
FNab09763 FN Test 100µg 702 EUR

ZXDC Polyclonal Antibody
A64870-020 EpiGentek 20 ul 117.7 EUR

ZXDC Polyclonal Antibody
A64870-050 EpiGentek 50 ul 302.5 EUR

ZXDC Polyclonal Antibody
A64870-100 EpiGentek 100 ul 423.5 EUR

ZXDC Polyclonal Antibody
A64870 EpiGentek
  • 684.66 EUR
  • 117.70 EUR
  • 302.50 EUR
  • 423.50 EUR
  • 100 µg
  • 20 ul
  • 50 ul
  • 100 ul

ZXDC Antibody, HRP conjugated
1-CSB-PA648494LB01HU Cusabio
  • 380.40 EUR
  • 402.00 EUR
  • 100ug
  • 50ug

ZXDC Antibody, FITC conjugated
1-CSB-PA648494LC01HU Cusabio
  • 380.40 EUR
  • 402.00 EUR
  • 100ug
  • 50ug

ZXDC Antibody, Biotin conjugated
1-CSB-PA648494LD01HU Cusabio
  • 380.40 EUR
  • 402.00 EUR
  • 100ug
  • 50ug

Mouse ZXDC shRNA Plasmid
20-abx979021 Abbexa
  • 961.20 EUR
  • 1345.20 EUR
  • 150 µg
  • 300 µg

Human ZXDC shRNA Plasmid
20-abx962371 Abbexa
  • 961.20 EUR
  • 1345.20 EUR
  • 150 µg
  • 300 µg

ZXDC ELISA KIT|Human
EF004534 Lifescience Market 96 Tests 826.8 EUR

Zxdc ORF Vector (Mouse) (pORF)
ORF062801 ABM 1.0 ug DNA 607.2 EUR

Zxdc ORF Vector (Mouse) (pORF)
ORF062802 ABM 1.0 ug DNA 607.2 EUR

ZXDC ORF Vector (Human) (pORF)
ORF012111 ABM 1.0 ug DNA 114 EUR

ZXDC Polyclonal Antibody, HRP Conjugated
A64871-050 EpiGentek 50 ul 302.5 EUR

ZXDC Polyclonal Antibody, HRP Conjugated
A64871-100 EpiGentek 100 ul 423.5 EUR

ZXDC Polyclonal Antibody, FITC Conjugated
A64872-050 EpiGentek 50 ul 302.5 EUR

ZXDC Polyclonal Antibody, FITC Conjugated
A64872-100 EpiGentek 100 ul 423.5 EUR

ZXDC Polyclonal Antibody, Biotin Conjugated
A64873-050 EpiGentek 50 ul 302.5 EUR

ZXDC Polyclonal Antibody, Biotin Conjugated
A64873-100 EpiGentek 100 ul 423.5 EUR

ZXDC Polyclonal Antibody, HRP Conjugated
A64871 EpiGentek
  • 684.66 EUR
  • 302.50 EUR
  • 423.50 EUR
  • 100 µg
  • 50 ul
  • 100 ul

ZXDC Polyclonal Antibody, FITC Conjugated
A64872 EpiGentek
  • 684.66 EUR
  • 302.50 EUR
  • 423.50 EUR
  • 100 µg
  • 50 ul
  • 100 ul

ZXDC Polyclonal Antibody, Biotin Conjugated
A64873 EpiGentek
  • 684.66 EUR
  • 302.50 EUR
  • 423.50 EUR
  • 100 µg
  • 50 ul
  • 100 ul

Zxdc sgRNA CRISPR Lentivector set (Mouse)
K4081401 ABM 3 x 1.0 ug 406.8 EUR

ZXDC sgRNA CRISPR Lentivector set (Human)
K2744201 ABM 3 x 1.0 ug 406.8 EUR

ZXD Family Zinc Finger C (ZXDC) Antibody
abx036152-100ug Abbexa 100 ug 469.2 EUR

ZXD Family Zinc Finger C (ZXDC) Antibody
20-abx307154 Abbexa
  • 493.20 EUR
  • 2214.00 EUR
  • 718.80 EUR
  • 218.40 EUR
  • 360.00 EUR
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

ZXD Family Zinc Finger C (ZXDC) Antibody
abx239763-100ug Abbexa 100 ug 661.2 EUR

Zxdc sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4081402 ABM 1.0 ug DNA 184.8 EUR

Zxdc sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4081403 ABM 1.0 ug DNA 184.8 EUR

Zxdc sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4081404 ABM 1.0 ug DNA 184.8 EUR

ZXDC sgRNA CRISPR Lentivector (Human) (Target 1)
K2744202 ABM 1.0 ug DNA 184.8 EUR

ZXDC sgRNA CRISPR Lentivector (Human) (Target 2)
K2744203 ABM 1.0 ug DNA 184.8 EUR

ZXDC sgRNA CRISPR Lentivector (Human) (Target 3)
K2744204 ABM 1.0 ug DNA 184.8 EUR

ZXDC Protein Vector (Human) (pPB-C-His)
PV048441 ABM 500 ng 394.8 EUR

ZXDC Protein Vector (Human) (pPB-N-His)
PV048442 ABM 500 ng 394.8 EUR

ZXDC Protein Vector (Human) (pPM-C-HA)
PV048443 ABM 500 ng 394.8 EUR

ZXDC Protein Vector (Human) (pPM-C-His)
PV048444 ABM 500 ng 394.8 EUR

ZXDC Protein Vector (Mouse) (pPB-C-His)
PV251202 ABM 500 ng 1278 EUR

ZXDC Protein Vector (Mouse) (pPB-N-His)
PV251203 ABM 500 ng 1278 EUR

ZXDC Protein Vector (Mouse) (pPM-C-HA)
PV251204 ABM 500 ng 1278 EUR

ZXDC Protein Vector (Mouse) (pPM-C-His)
PV251205 ABM 500 ng 1278 EUR

ZXDC Protein Vector (Mouse) (pPB-C-His)
PV251206 ABM 500 ng 1278 EUR

ZXDC Protein Vector (Mouse) (pPB-N-His)
PV251207 ABM 500 ng 1278 EUR

ZXDC Protein Vector (Mouse) (pPM-C-HA)
PV251208 ABM 500 ng 1278 EUR

ZXDC Protein Vector (Mouse) (pPM-C-His)
PV251209 ABM 500 ng 1278 EUR

ZXDC 3'UTR GFP Stable Cell Line
TU079581 ABM 1.0 ml 2799.6 EUR

Zxdc 3'UTR GFP Stable Cell Line
TU273955 ABM 1.0 ml Ask for price

ZXDC 3'UTR Luciferase Stable Cell Line
TU029581 ABM 1.0 ml 2799.6 EUR

Zxdc 3'UTR GFP Stable Cell Line
TU173056 ABM 1.0 ml Ask for price

Zxdc 3'UTR Luciferase Stable Cell Line
TU223955 ABM 1.0 ml Ask for price

Zxdc 3'UTR Luciferase Stable Cell Line
TU123056 ABM 1.0 ml Ask for price

ZXD Family Zinc Finger C (ZXDC) Antibody (HRP)
20-abx307155 Abbexa
  • 493.20 EUR
  • 2214.00 EUR
  • 718.80 EUR
  • 218.40 EUR
  • 360.00 EUR
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

ZXD Family Zinc Finger C (ZXDC) Antibody (FITC)
20-abx307156 Abbexa
  • 493.20 EUR
  • 2214.00 EUR
  • 718.80 EUR
  • 218.40 EUR
  • 360.00 EUR
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

ZXD Family Zinc Finger C (ZXDC) Antibody (Biotin)
20-abx307157 Abbexa
  • 493.20 EUR
  • 2214.00 EUR
  • 718.80 EUR
  • 218.40 EUR
  • 360.00 EUR
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Human ZXD Family Zinc Finger C (ZXDC) ELISA Kit
abx384516-96tests Abbexa 96 tests 1093.2 EUR

Zxdc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4081405 ABM 3 x 1.0 ug 451.2 EUR

ZXDC sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2744205 ABM 3 x 1.0 ug 451.2 EUR

Zxdc sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4081406 ABM 1.0 ug DNA 200.4 EUR

Zxdc sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4081407 ABM 1.0 ug DNA 200.4 EUR

Zxdc sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4081408 ABM 1.0 ug DNA 200.4 EUR

ZXDC sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2744206 ABM 1.0 ug DNA 200.4 EUR

ZXDC sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2744207 ABM 1.0 ug DNA 200.4 EUR

ZXDC sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2744208 ABM 1.0 ug DNA 200.4 EUR
Paraffin Wax Dispenser
HIS7000
Paraffin wax, granular (56 - 60)
GL4115-1KG
Paraffin wax, granular (56 - 60)
GL4115-5KG
MagSi-WAX
MD03025
MagSi-WAX
MD01025

RELATED ARTICLESMORE FROM AUTHOR

LEAVE A REPLY

Please enter your comment!
Please enter your name here