DESCRIPTION
Immunogen
Synthetic peptide directed towards the middle region of human ZXDC
Application
Anti-ZXDC antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
ZXD family zinc finger C (ZXDC; ZXDL) belongs to a family of transcription factors that are involved in regulation of major histocompatibility complex class II genes. ZXDC regulates genes involved in myeloid cell differentiation and CCL2 expression that is involved in inflammation responses.
Sequence
Synthetic peptide located within the following region: NLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPG
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Product Info Tested Species ReactivityHuman Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. ClonalityPolyclonal HostRabbit ApplicationWB Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ZXDC PurificationAffinity Purified Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% Complete computational species homology dataAnti-ZXDC (ARP50448_P050) Peptide SequenceSynthetic peptide located within the following region: NLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPG Concentration0.5 mg/ml Blocking PeptideFor anti-ZXDC (ARP50448_P050) antibody is Catalog # AAP50448 (Previous Catalog # AAPP29744) ReferenceJambunathan,S. (2007) Biol. Chem. 388 (9), 965-972.
Target Info
Gene Symbol | ZXDC |
---|---|
Gene Full Name | ZXD family zinc finger C |
Alias Symbols | ZXDL |
NCBI Gene Id | 79364 |
Protein Name | Zinc finger protein ZXDC |
Description of Target | ZXDC belongs to the ZXD family. It contains 10 C2H2-type zinc fingers. ZXDC cooperates with CIITA to promote transcription of MHC class I and MHC class II genes. |
Swissprot Id | Q2QGD7 |
Protein Accession # | NP_001035743 |
Nucleotide Accession # | NM_001040653 |
Protein Size (# AA) | 710 |
Molecular Weight | 75kDa |
Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express ZXDC. ![]() |
RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express ZXDC. ![]() |
Protein Interactions | POGZ; WDR5; ATXN1; APP; JTB; TK1; SMN1; SH3GL2; NR1H3; NR1H2; RORA; CIITA; |
Protocols & Data
- Protocol:
-
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.

Product FAQ
- What is the species homology for “ZXDC Antibody – middle region (ARP50448_P050)”?The tested species reactivity for this item is “Human”. This antibody is predicted to have homology to “Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish”.
- How long will it take to receive “ZXDC Antibody – middle region (ARP50448_P050)”?This item is available “Domestic: within 1-2 days delivery | International: 1-2 days”.
- What buffer format is “ZXDC Antibody – middle region (ARP50448_P050)” provided in?This item is provided in “Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.”.
Additional format options may be available. For more information please contact [email protected] - What are other names for “ZXDC Antibody – middle region (ARP50448_P050)”?This target may also be called “ZXDL” in publications.
- What is the shipping cost for “ZXDC Antibody – middle region (ARP50448_P050)”?The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
- What is the guarantee for “ZXDC Antibody – middle region (ARP50448_P050)”?All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
- Can I get bulk pricing for “ZXDC Antibody – middle region (ARP50448_P050)”?You can get bulk pricing for this item by going here.
- What is the molecular weight of the protein?The molecular weight reported by Uniprot for this item is “75kDa”.
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. - What protocols are available for “ZXDC Antibody – middle region (ARP50448_P050)”?We may have detailed protocol data avaialble for this item. To learn more, please view the “Protocols & Data” tab on the product page.
- What are positive controls for “ZXDC”?We have listed RNA Seq and gene expression data in the “Target Info” tab. You may be able to find adequate positive controls there.
- What are negative controls for “ZXDC”?We have listed RNA Seq and gene expression data in the “Target Info” tab. You may be able to find adequate positive controls there.
- What other proteins interact with “ZXDC”?This protein has been reported to interact with “Protein Interactions”. Please view the “Related Categories” tab on the product page for more information.
- What biological processes are associated with “ZXDC”?This protein has been associated with “Biological Processes”. Please view the “Related Categories” tab on the product page for more information.
- What cellular components are associated with “ZXDC”?This protein has been associated with “Cellular Components”. Please view the “Related Categories” tab on the product page for more information.
- What protein functions are associated with “ZXDC”?This protein has been associated with “Protein Functions”. Please view the “Related Categories” tab on the product page for more information.
Applications
- ELISA
- Applications tested for the base form of this product only
Usage
The applications listed above are for the unconjugated form of this antibody. The conjugated antibody has not been tested. The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.
Presentation
PBS, pH 7.4, 0.03% Proclin 300, 50% glycerol.
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
ZXDC Antibody |
|||
1-CSB-PA027161GA01HU | Cusabio |
|
|
ZXDC Antibody |
|||
1-CSB-PA648494LA01HU | Cusabio |
|
|
ZXDC siRNA |
|||
20-abx941262 | Abbexa |
|
|
ZXDC siRNA |
|||
20-abx941263 | Abbexa |
|
|
ZXDC antibody |
|||
70R-21424 | Fitzgerald | 50 ul | 435 EUR |
ZXDC antibody |
|||
70R-8902 | Fitzgerald | 50 ug | 467 EUR |
Human Zinc finger protein ZXDC, ZXDC ELISA KIT |
|||
ELI-17653h | Lifescience Market | 96 Tests | 824 EUR |
Mouse Zinc finger protein ZXDC, Zxdc ELISA KIT |
|||
ELI-17840m | Lifescience Market | 96 Tests | 865 EUR |
ZXDC cloning plasmid |
|||
CSB-CL648494HU-10ug | Cusabio | 10ug | 233 EUR |
ZXDC Polyclonal Antibody |
|||
A64870 | EpiGentek | 100 µg | 570.55 EUR |
anti- ZXDC antibody |
|||
FNab09763 | FN Test | 100µg | 585 EUR |
Anti-ZXDC antibody |
|||
PAab09763 | Lifescience Market | 100 ug | 412 EUR |
ZXDC Blocking Peptide |
|||
33R-6761 | Fitzgerald | 100 ug | 180 EUR |
ZXDC Antibody, HRP conjugated |
|||
1-CSB-PA648494LB01HU | Cusabio |
|
|
ZXDC Antibody, FITC conjugated |
|||
1-CSB-PA648494LC01HU | Cusabio |
|
|
ZXDC Antibody, Biotin conjugated |
|||
1-CSB-PA648494LD01HU | Cusabio |
|
|
Human ZXDC shRNA Plasmid |
|||
20-abx962371 | Abbexa |
|
|
Mouse ZXDC shRNA Plasmid |
|||
20-abx979021 | Abbexa |
|
|
ZXDC ELISA KIT|Human |
|||
EF004534 | Lifescience Market | 96 Tests | 689 EUR |
ZXDC Polyclonal Antibody, HRP Conjugated |
|||
A64871 | EpiGentek | 100 µg | 570.55 EUR |
ZXDC Polyclonal Antibody, FITC Conjugated |
|||
A64872 | EpiGentek | 100 µg | 570.55 EUR |
ZXDC Polyclonal Antibody, Biotin Conjugated |
|||
A64873 | EpiGentek | 100 µg | 570.55 EUR |
ZXDC ORF Vector (Human) (pORF) |
|||
ORF012111 | ABM | 1.0 ug DNA | 95 EUR |
Zxdc ORF Vector (Mouse) (pORF) |
|||
ORF062801 | ABM | 1.0 ug DNA | 506 EUR |
Zxdc ORF Vector (Mouse) (pORF) |
|||
ORF062802 | ABM | 1.0 ug DNA | 506 EUR |
Zxdc sgRNA CRISPR Lentivector set (Mouse) |
|||
K4081401 | ABM | 3 x 1.0 ug | 339 EUR |
ZXDC sgRNA CRISPR Lentivector set (Human) |
|||
K2744201 | ABM | 3 x 1.0 ug | 339 EUR |
ZXD Family Zinc Finger C (ZXDC) Antibody |
|||
20-abx307154 | Abbexa |
|
|
ZXD Family Zinc Finger C (ZXDC) Antibody |
|||
abx036152-100ug | Abbexa | 100 ug | 391 EUR |
ZXD Family Zinc Finger C (ZXDC) Antibody |
|||
abx239763-100ug | Abbexa | 100 ug | 551 EUR |
Zxdc sgRNA CRISPR Lentivector (Mouse) (Target 1) |
|||
K4081402 | ABM | 1.0 ug DNA | 154 EUR |
Zxdc sgRNA CRISPR Lentivector (Mouse) (Target 2) |
|||
K4081403 | ABM | 1.0 ug DNA | 154 EUR |
Zxdc sgRNA CRISPR Lentivector (Mouse) (Target 3) |
|||
K4081404 | ABM | 1.0 ug DNA | 154 EUR |
ZXDC sgRNA CRISPR Lentivector (Human) (Target 1) |
|||
K2744202 | ABM | 1.0 ug DNA | 154 EUR |
ZXDC sgRNA CRISPR Lentivector (Human) (Target 2) |
|||
K2744203 | ABM | 1.0 ug DNA | 154 EUR |
ZXDC sgRNA CRISPR Lentivector (Human) (Target 3) |
|||
K2744204 | ABM | 1.0 ug DNA | 154 EUR |
ZXDC Protein Vector (Human) (pPB-C-His) |
|||
PV048441 | ABM | 500 ng | 329 EUR |
ZXDC Protein Vector (Human) (pPB-N-His) |
|||
PV048442 | ABM | 500 ng | 329 EUR |
ZXDC Protein Vector (Human) (pPM-C-HA) |
|||
PV048443 | ABM | 500 ng | 329 EUR |
ZXDC Protein Vector (Human) (pPM-C-His) |
|||
PV048444 | ABM | 500 ng | 329 EUR |
ZXDC Protein Vector (Mouse) (pPB-C-His) |
|||
PV251202 | ABM | 500 ng | 1065 EUR |
ZXDC Protein Vector (Mouse) (pPB-N-His) |
|||
PV251203 | ABM | 500 ng | 1065 EUR |
ZXDC Protein Vector (Mouse) (pPM-C-HA) |
|||
PV251204 | ABM | 500 ng | 1065 EUR |
ZXDC Protein Vector (Mouse) (pPM-C-His) |
|||
PV251205 | ABM | 500 ng | 1065 EUR |
ZXDC Protein Vector (Mouse) (pPB-C-His) |
|||
PV251206 | ABM | 500 ng | 1065 EUR |
ZXDC Protein Vector (Mouse) (pPB-N-His) |
|||
PV251207 | ABM | 500 ng | 1065 EUR |
ZXDC Protein Vector (Mouse) (pPM-C-HA) |
|||
PV251208 | ABM | 500 ng | 1065 EUR |
ZXDC Protein Vector (Mouse) (pPM-C-His) |
|||
PV251209 | ABM | 500 ng | 1065 EUR |
ZXDC 3'UTR GFP Stable Cell Line |
|||
TU079581 | ABM | 1.0 ml | 2333 EUR |
Zxdc 3'UTR Luciferase Stable Cell Line |
|||
TU223955 | ABM | 1.0 ml | Ask for price |
Zxdc 3'UTR GFP Stable Cell Line |
|||
TU173056 | ABM | 1.0 ml | Ask for price |
Zxdc 3'UTR GFP Stable Cell Line |
|||
TU273955 | ABM | 1.0 ml | Ask for price |
ZXDC 3'UTR Luciferase Stable Cell Line |
|||
TU029581 | ABM | 1.0 ml | 2333 EUR |
Zxdc 3'UTR Luciferase Stable Cell Line |
|||
TU123056 | ABM | 1.0 ml | Ask for price |
ZXD Family Zinc Finger C (ZXDC) Antibody (HRP) |
|||
20-abx307155 | Abbexa |
|
|
ZXD Family Zinc Finger C (ZXDC) Antibody (FITC) |
|||
20-abx307156 | Abbexa |
|
|
ZXD Family Zinc Finger C (ZXDC) Antibody (Biotin) |
|||
20-abx307157 | Abbexa |
|
|
Human ZXD Family Zinc Finger C (ZXDC) ELISA Kit |
|||
abx384516-96tests | Abbexa | 96 tests | 911 EUR |
Zxdc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse) |
|||
K4081405 | ABM | 3 x 1.0 ug | 376 EUR |
ZXDC sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human) |
|||
K2744205 | ABM | 3 x 1.0 ug | 376 EUR |
Zxdc sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1) |
|||
K4081406 | ABM | 1.0 ug DNA | 167 EUR |
Zxdc sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2) |
|||
K4081407 | ABM | 1.0 ug DNA | 167 EUR |
Zxdc sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3) |
|||
K4081408 | ABM | 1.0 ug DNA | 167 EUR |
ZXDC sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1) |
|||
K2744206 | ABM | 1.0 ug DNA | 167 EUR |
ZXDC sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2) |
|||
K2744207 | ABM | 1.0 ug DNA | 167 EUR |
ZXDC sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3) |
|||
K2744208 | ABM | 1.0 ug DNA | 167 EUR |