DESCRIPTION

Immunogen

Synthetic peptide directed towards the middle region of human ZXDC

Application

Anti-ZXDC antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

ZXD family zinc finger C (ZXDC; ZXDL) belongs to a family of transcription factors that are involved in regulation of major histocompatibility complex class II genes. ZXDC regulates genes involved in myeloid cell differentiation and CCL2 expression that is involved in inflammation responses.
Paraffin Wax
Paraffin wax pellets
Paraffin wax pellets
Paraffin wax Pellets
Paraffin wax Pellets
Paraffin wax (noncaking)
Paraffin wax (noncaking)
Paraffin wax (noncaking)
Paraffin Wax (Non-Caking)
Paraffin Wax (Non-Caking)

Sequence

Synthetic peptide located within the following region: NLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
MULTIPLEX KIT PCR MASTITIS PCR kit
PCR-MPX218-48D Bioingentech
MULTIPLEX KIT PCR MASTITIS PCR kit
PCR-MPX218-96D Bioingentech
MULTIPLEX KIT PCR Babesia & Theileria PCR kit
PCR-MPX401-48D Bioingentech
MULTIPLEX KIT PCR Babesia & Theileria PCR kit
PCR-MPX401-96D Bioingentech
Leaf PCR Kit
11140007-1 Glycomatrix

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Product Info Tested Species ReactivityHuman Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. ClonalityPolyclonal HostRabbit ApplicationWB Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ZXDC PurificationAffinity Purified Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% Complete computational species homology dataAnti-ZXDC (ARP50448_P050) Peptide SequenceSynthetic peptide located within the following region: NLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPG Concentration0.5 mg/ml Blocking PeptideFor anti-ZXDC (ARP50448_P050) antibody is Catalog # AAP50448 (Previous Catalog # AAPP29744) ReferenceJambunathan,S. (2007) Biol. Chem. 388 (9), 965-972.
Target Info
Gene Symbol ZXDC
Gene Full Name ZXD family zinc finger C
Alias Symbols ZXDL
NCBI Gene Id 79364
Protein Name Zinc finger protein ZXDC
Description of Target ZXDC belongs to the ZXD family. It contains 10 C2H2-type zinc fingers. ZXDC cooperates with CIITA to promote transcription of MHC class I and MHC class II genes.
Swissprot Id Q2QGD7
Protein Accession # NP_001035743
Nucleotide Accession # NM_001040653
Protein Size (# AA) 710
Molecular Weight 75kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ZXDC. 
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ZXDC. 
Protein Interactions POGZ; WDR5; ATXN1; APP; JTB; TK1; SMN1; SH3GL2; NR1H3; NR1H2; RORA; CIITA;
Protocols & Data
Protocol:
  • Reconstitution & Storage Instructions
  • Western Blotting/Immunoblotting (WB/IB) Protocol
  • Immunohistochemistry (IHC) Protocol
  • Immunocytochemistry (ICC) Protocol
  • Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
  • Blocking Peptide Competition Protocol (BPCP)
  • Immunoprecipitation (IP) Protocol
  • Antibody Array (AA) Protocol
Tips Information:
  • IHC Tips & Tricks
  • ICC Tips & Tricks
  • ELISA Tips & Tricks
  • WB/IB Tips & Tricks
  • IP Tips & Tricks

See our General FAQ page.

Related Categories
Protein interactions
Name # of Products
CIITA 27
JTB 2
NR1H2 93
NR1H3 71
RORA 51
SH3GL2 130
SMN1 388
TK1 389
Biological pathways
Name # of Products
Positive regulation of transcription, DNA-dependent 694
Transcription, DNA-dependent 3394
Biological process
Name # of Products
Positive regulation of transcription, DNA-dependent 681
Cellular components
Name # of Products
Cellular_component 556
Intracellular 1678
Nucleus 4914
Protein function
Name # of Products
C2H2 zinc finger domain binding 39
LRR domain binding 12
Metal ion binding 5514
Nucleic acid binding 617
Protein binding 12191
Sequence-specific DNA binding transcription factor activity 2776
Zinc ion binding 3721
ZXDC Antibody
ZXDC Antibody
Product FAQ
  1. What is the species homology for “ZXDC Antibody – middle region (ARP50448_P050)”?The tested species reactivity for this item is “Human”. This antibody is predicted to have homology to “Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish”.
  2. How long will it take to receive “ZXDC Antibody – middle region (ARP50448_P050)”?This item is available “Domestic: within 1-2 days delivery | International: 1-2 days”.
  3. What buffer format is “ZXDC Antibody – middle region (ARP50448_P050)” provided in?This item is provided in “Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.”.
    Additional format options may be available. For more information please contact [email protected].
  4. What are other names for “ZXDC Antibody – middle region (ARP50448_P050)”?This target may also be called “ZXDL” in publications.
  5. What is the shipping cost for “ZXDC Antibody – middle region (ARP50448_P050)”?The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
  6. What is the guarantee for “ZXDC Antibody – middle region (ARP50448_P050)”?All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
  7. Can I get bulk pricing for “ZXDC Antibody – middle region (ARP50448_P050)”?You can get bulk pricing for this item by going here.
  8. What is the molecular weight of the protein?The molecular weight reported by Uniprot for this item is “75kDa”.
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
  9. What protocols are available for “ZXDC Antibody – middle region (ARP50448_P050)”?We may have detailed protocol data avaialble for this item. To learn more, please view the “Protocols & Data” tab on the product page.
  10. What are positive controls for “ZXDC”?We have listed RNA Seq and gene expression data in the “Target Info” tab. You may be able to find adequate positive controls there.
  11. What are negative controls for “ZXDC”?We have listed RNA Seq and gene expression data in the “Target Info” tab. You may be able to find adequate positive controls there.
  12. What other proteins interact with “ZXDC”?This protein has been reported to interact with “Protein Interactions”. Please view the “Related Categories” tab on the product page for more information.
  13. What biological processes are associated with “ZXDC”?This protein has been associated with “Biological Processes”. Please view the “Related Categories” tab on the product page for more information.
  14. What cellular components are associated with “ZXDC”?This protein has been associated with “Cellular Components”. Please view the “Related Categories” tab on the product page for more information.
  15. What protein functions are associated with “ZXDC”?This protein has been associated with “Protein Functions”. Please view the “Related Categories” tab on the product page for more information.
Applications
  • ELISA
  • Applications tested for the base form of this product only
Paraffin Wax
Paraffin wax pellets
Paraffin wax pellets
Paraffin wax Pellets
Paraffin wax Pellets
Paraffin wax (noncaking)
Paraffin wax (noncaking)
Paraffin wax (noncaking)
Paraffin Wax (Non-Caking)
Paraffin Wax (Non-Caking)
Usage
The applications listed above are for the unconjugated form of this antibody. The conjugated antibody has not been tested. The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.
Presentation
PBS, pH 7.4, 0.03% Proclin 300, 50% glycerol.
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.

ZXDC
CSB-CL648494HU Cusabio 10 μg plasmid + 200μl Glycerol Ask for price

ZXDC siRNA
20-abx941262 Abbexa
  • Ask for price
  • Ask for price
  • 15 nmol
  • 30 nmol

ZXDC siRNA
20-abx941263 Abbexa
  • Ask for price
  • Ask for price
  • 15 nmol
  • 30 nmol

ZXDC Peptide
MBS3234896-01mg MyBiosource 0.1mg 180 EUR

ZXDC Peptide
MBS3234896-5x01mg MyBiosource 5x0.1mg 730 EUR

Human Zinc finger protein ZXDC, ZXDC ELISA KIT
ELI-17653h Nova Lifetech 96tests 696 EUR

Mouse Zinc finger protein ZXDC, Zxdc ELISA KIT
ELI-17840m Nova Lifetech 96tests 736 EUR

Mouse Zinc finger protein ZXDC (ZXDC) ELISA Kit
abx555302-96tests Abbexa 96 tests 687.5 EUR

Human Zinc finger protein ZXDC, ZXDC ELISA Kit
MBS9329937-10x96StripWells MyBiosource 10x96-Strip-Wells 6725 EUR

Human Zinc finger protein ZXDC, ZXDC ELISA Kit
MBS9329937-48StripWells MyBiosource 48-Strip-Wells 550 EUR

Human Zinc finger protein ZXDC, ZXDC ELISA Kit
MBS9329937-5x96StripWells MyBiosource 5x96-Strip-Wells 3420 EUR

Human Zinc finger protein ZXDC, ZXDC ELISA Kit
MBS9329937-96StripWells MyBiosource 96-Strip-Wells 765 EUR

Mouse Zinc finger protein ZXDC, ZXDC ELISA Kit
MBS9328728-10x96StripWells MyBiosource 10x96-Strip-Wells 6725 EUR

Mouse Zinc finger protein ZXDC, ZXDC ELISA Kit
MBS9328728-48StripWells MyBiosource 48-Strip-Wells 550 EUR

Mouse Zinc finger protein ZXDC, ZXDC ELISA Kit
MBS9328728-5x96StripWells MyBiosource 5x96-Strip-Wells 3420 EUR

Mouse Zinc finger protein ZXDC, ZXDC ELISA Kit
MBS9328728-96StripWells MyBiosource 96-Strip-Wells 765 EUR

ZXDC Antibody
E93494 EnoGene 100μg 255 EUR

ZXDC Antibody
E306837 EnoGene 100ug/200ul 275 EUR

ZXDC antibody
70R-21424 Fitzgerald 50 ul 289 EUR

ZXDC antibody
70R-8902 Fitzgerald 50 ug 467 EUR

ZXDC Antibody
1-CSB-PA027161GA01HU Cusabio
  • Ask for price
  • Ask for price
  • 150ul
  • 50ul

ZXDC Antibody
1-CSB-PA648494LA01HU Cusabio
  • Ask for price
  • Ask for price
  • 100ug
  • 50ug

ZXDC Antibody
GWB-MR909I GenWay Biotech 50ug Ask for price

ZXDC Antibody
MBS7002954-005mg MyBiosource 0.05mg 190 EUR

ZXDC Antibody
MBS7002954-01mg MyBiosource 0.1mg 270 EUR

ZXDC Antibody
MBS7002954-5x01mg MyBiosource 5x0.1mg 1205 EUR

ZXDC Antibody
MBS858904-01mg MyBiosource 0.1mg 345 EUR

ZXDC Antibody
MBS858904-01mLAF405L MyBiosource 0.1mL(AF405L) 565 EUR

ZXDC Antibody
MBS858904-01mLAF405S MyBiosource 0.1mL(AF405S) 565 EUR

ZXDC Antibody
MBS858904-01mLAF610 MyBiosource 0.1mL(AF610) 565 EUR

ZXDC Antibody
MBS858904-01mLAF635 MyBiosource 0.1mL(AF635) 565 EUR

ZXDC Antibody
MBS8500388-01mg MyBiosource 0.1mg 325 EUR

ZXDC Antibody
MBS8500388-01mLAF405L MyBiosource 0.1mL(AF405L) 565 EUR

ZXDC Antibody
MBS8500388-01mLAF405S MyBiosource 0.1mL(AF405S) 565 EUR

ZXDC Antibody
MBS8500388-01mLAF610 MyBiosource 0.1mL(AF610) 565 EUR

ZXDC Antibody
MBS8500388-01mLAF635 MyBiosource 0.1mL(AF635) 565 EUR

Recombinant Human Zinc finger protein ZXDC (ZXDC) , partial
MBS1302541-INQUIRE MyBiosource INQUIRE Ask for price

Recombinant Mouse Zinc finger protein ZXDC (Zxdc) , partial
MBS1423505-INQUIRE MyBiosource INQUIRE Ask for price

ZXDC cDNA Clone
MBS1275350-001mgPlasmid02mLGlycerolStock MyBiosource 0.01mgPlasmid+0.2mLGlycerol-Stock 200 EUR

ZXDC cDNA Clone
MBS1275350-5x001mgPlasmid5x02mLGlycerolStock MyBiosource 5x0.01mgPlasmid+5x0.2mLGlycerol-Stock 855 EUR

Mouse ZXDC siRNA
abx941262-150g Abbexa 150 µg 450 EUR

Mouse ZXDC siRNA
abx941262-300g Abbexa 300 µg 612.5 EUR

Human ZXDC siRNA
abx941263-150g Abbexa 150 µg 450 EUR

Human ZXDC siRNA
abx941263-300g Abbexa 300 µg 612.5 EUR

ZXDC siRNA (Human)
MBS8226946-15nmol MyBiosource 15nmol 405 EUR

ZXDC siRNA (Human)
MBS8226946-30nmol MyBiosource 30nmol 565 EUR

ZXDC siRNA (Human)
MBS8226946-5x30nmol MyBiosource 5x30nmol 2450 EUR

ZXDC siRNA (Mouse)
MBS828452-15nmol MyBiosource 15nmol 405 EUR

ZXDC siRNA (Mouse)
MBS828452-30nmol MyBiosource 30nmol 565 EUR

ZXDC siRNA (Mouse)
MBS828452-5x30nmol MyBiosource 5x30nmol 2450 EUR

anti- ZXDC antibody
FNab09763 FN Test 100µg 702 EUR

ZXDC cloning plasmid
CSB-CL648494HU-10ug Cusabio 10ug 279.6 EUR

ZXDC Blocking Peptide
33R-6761 Fitzgerald 100 ug 119 EUR

ZXDC Polyclonal Antibody
A64870 EpiGentek
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100 µg
  • 20 ul
  • 50 ul
  • 100 ul

ZXDC Polyclonal Antibody
MBS9235812-01mL MyBiosource 0.1mL 415 EUR

ZXDC Polyclonal Antibody
MBS9235812-5x01mL MyBiosource 5x0.1mL 1841 EUR

Human ZXDC ELISA KIT
EF004534 Nova Lifetech 96tests 566 EUR

ZXDC (untagged)-Human ZXD family zinc finger C (ZXDC), transcript variant 1
SC318335 Origene Technologies GmbH 10 µg Ask for price

ZXDC (untagged)-Human ZXD family zinc finger C (ZXDC), transcript variant 2
SC311148 Origene Technologies GmbH 10 µg Ask for price

ZXDC (untagged)-Human ZXD family zinc finger C (ZXDC), transcript variant 1
SC110802 Origene Technologies GmbH 10 µg Ask for price

Mouse ZXDC shRNA Plasmid
20-abx979021 Abbexa
  • Ask for price
  • Ask for price
  • 150 µg
  • 300 µg

Human ZXDC shRNA Plasmid
20-abx962371 Abbexa
  • Ask for price
  • Ask for price
  • 150 µg
  • 300 µg

ZXDC antibody - middle region
MBS3209941-01mL MyBiosource 0.1mL 455 EUR

ZXDC antibody - middle region
MBS3209941-5x01mL MyBiosource 5x0.1mL 1995 EUR

ZXDC Antibody, HRP conjugated
1-CSB-PA648494LB01HU Cusabio
  • Ask for price
  • Ask for price
  • 100ug
  • 50ug

ZXDC Antibody; HRP conjugated
MBS7001850-005mg MyBiosource 0.05mg 190 EUR

ZXDC Antibody; HRP conjugated
MBS7001850-01mg MyBiosource 0.1mg 270 EUR

ZXDC Antibody; HRP conjugated
MBS7001850-5x01mg MyBiosource 5x0.1mg 1205 EUR

Zxdc (GFP-tagged) - Mouse ZXD family zinc finger C (Zxdc), transcript variant 1
MG210478 Origene Technologies GmbH 10 µg Ask for price

ZXDC (GFP-tagged) - Human ZXD family zinc finger C (ZXDC), transcript variant 2
RG217502 Origene Technologies GmbH 10 µg Ask for price

ZXDC (GFP-tagged) - Human ZXD family zinc finger C (ZXDC), transcript variant 1
RG218266 Origene Technologies GmbH 10 µg Ask for price

Zxdc (untagged) - Mouse ZXD family zinc finger C (Zxdc), transcript variant 1, (10ug)
MC200020 Origene Technologies GmbH 10 µg Ask for price

AAP50448-100UG - ZXDC Peptide
AAP50448-100UG Aviva Systems Biology 100ug 99 EUR

ZXDC Antibody, FITC conjugated
1-CSB-PA648494LC01HU Cusabio
  • Ask for price
  • Ask for price
  • 100ug
  • 50ug

ZXDC Antibody; FITC conjugated
MBS7004484-005mg MyBiosource 0.05mg 190 EUR

ZXDC Antibody; FITC conjugated
MBS7004484-01mg MyBiosource 0.1mg 270 EUR

ZXDC Antibody; FITC conjugated
MBS7004484-5x01mg MyBiosource 5x0.1mg 1205 EUR

ZXDC Antibody, Biotin conjugated
1-CSB-PA648494LD01HU Cusabio
  • Ask for price
  • Ask for price
  • 100ug
  • 50ug

ZXDC Antibody; Biotin conjugated
MBS7000409-005mg MyBiosource 0.05mg 190 EUR

ZXDC Antibody; Biotin conjugated
MBS7000409-01mg MyBiosource 0.1mg 270 EUR

ZXDC Antibody; Biotin conjugated
MBS7000409-5x01mg MyBiosource 5x0.1mg 1205 EUR

Zxdc (Myc-DDK-tagged) - Mouse ZXD family zinc finger C (Zxdc), transcript variant 1
MR210478 Origene Technologies GmbH 10 µg Ask for price

Zxdc (Myc-DDK-tagged) - Mouse ZXD family zinc finger C (Zxdc), transcript variant 2
MR224935 Origene Technologies GmbH 10 µg Ask for price

Zxdc (GFP-tagged) - Mouse ZXD family zinc finger C (Zxdc) transcript variant 2, (10ug)
MG224935 Origene Technologies GmbH 10 µg Ask for price

ZXDC (Myc-DDK-tagged)-Human ZXD family zinc finger C (ZXDC), transcript variant 1
RC218266 Origene Technologies GmbH 10 µg Ask for price

ZXDC (Myc-DDK-tagged)-Human ZXD family zinc finger C (ZXDC), transcript variant 2
RC217502 Origene Technologies GmbH 10 µg Ask for price

ZXDC ORF Vector (Human) (pORF)
ORF012111 ABM 1.0 ug DNA 114 EUR

Zxdc ORF Vector (Mouse) (pORF)
ORF062801 ABM 1.0 ug DNA 607.2 EUR

Zxdc ORF Vector (Mouse) (pORF)
ORF062802 ABM 1.0 ug DNA 607.2 EUR

Human ZXDC knockout cell line
ABC-KH17908 AcceGen 1 vial Ask for price

Human ZXDC knockdown cell line
ABC-KD17908 AcceGen 1 vial Ask for price

ZXDC Peptide - N-terminal region
MBS3245516-01mg MyBiosource 0.1mg 180 EUR

ZXDC Peptide - N-terminal region
MBS3245516-5x01mg MyBiosource 5x0.1mg 730 EUR

ZXDC Antibody - N-terminal region
MBS3220714-01mL MyBiosource 0.1mL 455 EUR

ZXDC Antibody - N-terminal region
MBS3220714-5x01mL MyBiosource 5x0.1mL 1995 EUR

Recombinant Human ZXDC, His-tagged
ZXDC-3888H Creative BioMart 25ug 255.2 EUR

ZXDC Polyclonal Antibody, HRP Conjugated
A64871 EpiGentek
  • Ask for price
  • Ask for price
  • Ask for price
  • 100 µg
  • 50 ul
  • 100 ul

ZXDC Polyclonal Antibody, FITC Conjugated
A64872 EpiGentek
  • Ask for price
  • Ask for price
  • Ask for price
  • 100 µg
  • 50 ul
  • 100 ul

ZXDC Polyclonal Antibody, Biotin Conjugated
A64873 EpiGentek
  • Ask for price
  • Ask for price
  • Ask for price
  • 100 µg
  • 50 ul
  • 100 ul

Lenti ORF clone of Zxdc (mGFP-tagged) - Mouse ZXD family zinc finger C (Zxdc), transcript variant 1
MR210478L4 Origene Technologies GmbH 10 µg Ask for price

Lenti ORF clone of Zxdc (mGFP-tagged) - Mouse ZXD family zinc finger C (Zxdc), transcript variant 2
MR224935L4 Origene Technologies GmbH 10 µg Ask for price

Lenti-ORF clone of ZXDC (mGFP-tagged)-Human ZXD family zinc finger C (ZXDC), transcript variant 2
RC217502L4 Origene Technologies GmbH 10 µg Ask for price

ZXDC sgRNA CRISPR Lentivector set (Human)
K2744201 ABM 3 x 1.0 ug 406.8 EUR

Zxdc sgRNA CRISPR Lentivector set (Mouse)
K4081401 ABM 3 x 1.0 ug 406.8 EUR

Zxdc 3'UTR GFP Stable Cell Line
TU173056 ABM 1.0 ml Ask for price

Zxdc 3'UTR GFP Stable Cell Line
TU273955 ABM 1.0 ml Ask for price

ZXDC 3'UTR GFP Stable Cell Line
TU079581 ABM 1.0 ml 2799.6 EUR

ZXD Family Zinc Finger C (ZXDC) Antibody
abx036152-100ug Abbexa 100 ug 469.2 EUR

ZXD Family Zinc Finger C (ZXDC) Antibody
20-abx307154 Abbexa
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

ZXD Family Zinc Finger C (ZXDC) Antibody
abx239763-100ug Abbexa 100 ug 661.2 EUR

ZXD Family Zinc Finger C (ZXDC) Antibody
abx307154-100g Abbexa 100 µg 362.5 EUR

ZXD Family Zinc Finger C (ZXDC) Antibody
abx307154-20g Abbexa 20 µg 162.5 EUR

ZXD Family Zinc Finger C (ZXDC) Antibody
abx307154-50g Abbexa 50 µg 250 EUR

ZXD Family Zinc Finger C (ZXDC) Antibody
abx036152-100g Abbexa 100 µg 337.5 EUR

ZXD Family Zinc Finger C (ZXDC) Antibody
abx239763-100l Abbexa 100 µl Ask for price

ZXD Family Zinc Finger C (ZXDC) Antibody
abx239763-50l Abbexa 50 µl 350 EUR

Lenti ORF clone of Zxdc (Myc-DDK-tagged) - Mouse ZXD family zinc finger C (Zxdc), transcript variant 1
MR210478L3 Origene Technologies GmbH 10 µg Ask for price
Paraffin Wax
P191410
Paraffin wax pellets
GRM10702-2KG
Paraffin wax pellets
GRM10702-500G
Paraffin wax Pellets
GRM10702W-2KG
Paraffin wax Pellets
GRM10702W-500G

RELATED ARTICLESMORE FROM AUTHOR

LEAVE A REPLY

Please enter your comment!
Please enter your name here