DESCRIPTION
Immunogen
Synthetic peptide directed towards the middle region of human ZXDC
Application
Anti-ZXDC antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
ZXD family zinc finger C (ZXDC; ZXDL) belongs to a family of transcription factors that are involved in regulation of major histocompatibility complex class II genes. ZXDC regulates genes involved in myeloid cell differentiation and CCL2 expression that is involved in inflammation responses.
Sequence
Synthetic peptide located within the following region: NLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPG
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
MULTIPLEX KIT PCR MASTITIS PCR kit | |
PCR-MPX218-48D | Bioingentech |
MULTIPLEX KIT PCR MASTITIS PCR kit | |
PCR-MPX218-96D | Bioingentech |
MULTIPLEX KIT PCR Babesia & Theileria PCR kit | |
PCR-MPX401-48D | Bioingentech |
MULTIPLEX KIT PCR Babesia & Theileria PCR kit | |
PCR-MPX401-96D | Bioingentech |
Leaf PCR Kit | |
11140007-1 | Bio-WORLD |
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Product Info Tested Species ReactivityHuman Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. ClonalityPolyclonal HostRabbit ApplicationWB Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ZXDC PurificationAffinity Purified Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% Complete computational species homology dataAnti-ZXDC (ARP50448_P050) Peptide SequenceSynthetic peptide located within the following region: NLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPG Concentration0.5 mg/ml Blocking PeptideFor anti-ZXDC (ARP50448_P050) antibody is Catalog # AAP50448 (Previous Catalog # AAPP29744) ReferenceJambunathan,S. (2007) Biol. Chem. 388 (9), 965-972.
Target Info
Gene Symbol | ZXDC |
---|---|
Gene Full Name | ZXD family zinc finger C |
Alias Symbols | ZXDL |
NCBI Gene Id | 79364 |
Protein Name | Zinc finger protein ZXDC |
Description of Target | ZXDC belongs to the ZXD family. It contains 10 C2H2-type zinc fingers. ZXDC cooperates with CIITA to promote transcription of MHC class I and MHC class II genes. |
Swissprot Id | Q2QGD7 |
Protein Accession # | NP_001035743 |
Nucleotide Accession # | NM_001040653 |
Protein Size (# AA) | 710 |
Molecular Weight | 75kDa |
Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express ZXDC. ![]() |
RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express ZXDC. ![]() |
Protein Interactions | POGZ; WDR5; ATXN1; APP; JTB; TK1; SMN1; SH3GL2; NR1H3; NR1H2; RORA; CIITA; |
Protocols & Data
- Protocol:
-
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.

Product FAQ
- What is the species homology for “ZXDC Antibody – middle region (ARP50448_P050)”?The tested species reactivity for this item is “Human”. This antibody is predicted to have homology to “Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish”.
- How long will it take to receive “ZXDC Antibody – middle region (ARP50448_P050)”?This item is available “Domestic: within 1-2 days delivery | International: 1-2 days”.
- What buffer format is “ZXDC Antibody – middle region (ARP50448_P050)” provided in?This item is provided in “Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.”.
Additional format options may be available. For more information please contact [email protected]. - What are other names for “ZXDC Antibody – middle region (ARP50448_P050)”?This target may also be called “ZXDL” in publications.
- What is the shipping cost for “ZXDC Antibody – middle region (ARP50448_P050)”?The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
- What is the guarantee for “ZXDC Antibody – middle region (ARP50448_P050)”?All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
- Can I get bulk pricing for “ZXDC Antibody – middle region (ARP50448_P050)”?You can get bulk pricing for this item by going here.
- What is the molecular weight of the protein?The molecular weight reported by Uniprot for this item is “75kDa”.
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. - What protocols are available for “ZXDC Antibody – middle region (ARP50448_P050)”?We may have detailed protocol data avaialble for this item. To learn more, please view the “Protocols & Data” tab on the product page.
- What are positive controls for “ZXDC”?We have listed RNA Seq and gene expression data in the “Target Info” tab. You may be able to find adequate positive controls there.
- What are negative controls for “ZXDC”?We have listed RNA Seq and gene expression data in the “Target Info” tab. You may be able to find adequate positive controls there.
- What other proteins interact with “ZXDC”?This protein has been reported to interact with “Protein Interactions”. Please view the “Related Categories” tab on the product page for more information.
- What biological processes are associated with “ZXDC”?This protein has been associated with “Biological Processes”. Please view the “Related Categories” tab on the product page for more information.
- What cellular components are associated with “ZXDC”?This protein has been associated with “Cellular Components”. Please view the “Related Categories” tab on the product page for more information.
- What protein functions are associated with “ZXDC”?This protein has been associated with “Protein Functions”. Please view the “Related Categories” tab on the product page for more information.
Applications
- ELISA
- Applications tested for the base form of this product only
Usage
The applications listed above are for the unconjugated form of this antibody. The conjugated antibody has not been tested. The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.
Presentation
PBS, pH 7.4, 0.03% Proclin 300, 50% glycerol.
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
ZXDC |
|||
CSB-CL648494HU | Cusabio | 10 μg plasmid + 200μl Glycerol | Ask for price |
ZXDC siRNA |
|||
20-abx941262 | Abbexa |
|
|
ZXDC siRNA |
|||
20-abx941263 | Abbexa |
|
|
ZXDC Peptide |
|||
MBS3234896-01mg | MyBiosource | 0.1mg | 180 EUR |
ZXDC Peptide |
|||
MBS3234896-5x01mg | MyBiosource | 5x0.1mg | 730 EUR |
ZXDC antibody |
|||
70R-8902 | Fitzgerald | 50 ug | 467 EUR |
ZXDC antibody |
|||
70R-21424 | Fitzgerald | 50 ul | 289 EUR |
ZXDC Antibody |
|||
1-CSB-PA027161GA01HU | Cusabio |
|
|
ZXDC Antibody |
|||
1-CSB-PA648494LA01HU | Cusabio |
|
|
ZXDC Antibody |
|||
E93494 | EnoGene | 100μg | 255 EUR |
ZXDC Antibody |
|||
E306837 | EnoGene | 100ug/200ul | 275 EUR |
ZXDC Antibody |
|||
GWB-MR909I | GenWay Biotech | 50ug | Ask for price |
ZXDC Antibody |
|||
MBS7002954-005mg | MyBiosource | 0.05mg | 190 EUR |
ZXDC Antibody |
|||
MBS7002954-01mg | MyBiosource | 0.1mg | 270 EUR |
ZXDC Antibody |
|||
MBS7002954-5x01mg | MyBiosource | 5x0.1mg | 1205 EUR |
ZXDC Antibody |
|||
MBS8500388-01mg | MyBiosource | 0.1mg | 325 EUR |
ZXDC Antibody |
|||
MBS8500388-01mLAF405L | MyBiosource | 0.1mL(AF405L) | 565 EUR |
ZXDC Antibody |
|||
MBS8500388-01mLAF405S | MyBiosource | 0.1mL(AF405S) | 565 EUR |
ZXDC Antibody |
|||
MBS8500388-01mLAF610 | MyBiosource | 0.1mL(AF610) | 565 EUR |
ZXDC Antibody |
|||
MBS8500388-01mLAF635 | MyBiosource | 0.1mL(AF635) | 565 EUR |
ZXDC Antibody |
|||
MBS858904-01mg | MyBiosource | 0.1mg | 345 EUR |
ZXDC Antibody |
|||
MBS858904-01mLAF405L | MyBiosource | 0.1mL(AF405L) | 565 EUR |
ZXDC Antibody |
|||
MBS858904-01mLAF405S | MyBiosource | 0.1mL(AF405S) | 565 EUR |
ZXDC Antibody |
|||
MBS858904-01mLAF610 | MyBiosource | 0.1mL(AF610) | 565 EUR |
ZXDC Antibody |
|||
MBS858904-01mLAF635 | MyBiosource | 0.1mL(AF635) | 565 EUR |
Mouse Zinc finger protein ZXDC (ZXDC) ELISA Kit |
|||
abx555302-96tests | Abbexa | 96 tests | 687.5 EUR |
Human Zinc finger protein ZXDC, ZXDC ELISA KIT |
|||
ELI-17653h | Lifescience Market | 96 Tests | 988.8 EUR |
Mouse Zinc finger protein ZXDC, Zxdc ELISA KIT |
|||
ELI-17840m | Lifescience Market | 96 Tests | 1038 EUR |
Human Zinc finger protein ZXDC, ZXDC ELISA Kit |
|||
MBS9329937-10x96StripWells | MyBiosource | 10x96-Strip-Wells | 6725 EUR |
Human Zinc finger protein ZXDC, ZXDC ELISA Kit |
|||
MBS9329937-48StripWells | MyBiosource | 48-Strip-Wells | 550 EUR |
Human Zinc finger protein ZXDC, ZXDC ELISA Kit |
|||
MBS9329937-5x96StripWells | MyBiosource | 5x96-Strip-Wells | 3420 EUR |
Human Zinc finger protein ZXDC, ZXDC ELISA Kit |
|||
MBS9329937-96StripWells | MyBiosource | 96-Strip-Wells | 765 EUR |
Mouse Zinc finger protein ZXDC, ZXDC ELISA Kit |
|||
MBS9328728-10x96StripWells | MyBiosource | 10x96-Strip-Wells | 6725 EUR |
Mouse Zinc finger protein ZXDC, ZXDC ELISA Kit |
|||
MBS9328728-48StripWells | MyBiosource | 48-Strip-Wells | 550 EUR |
Mouse Zinc finger protein ZXDC, ZXDC ELISA Kit |
|||
MBS9328728-5x96StripWells | MyBiosource | 5x96-Strip-Wells | 3420 EUR |
Mouse Zinc finger protein ZXDC, ZXDC ELISA Kit |
|||
MBS9328728-96StripWells | MyBiosource | 96-Strip-Wells | 765 EUR |
Recombinant Human Zinc finger protein ZXDC (ZXDC) , partial |
|||
MBS1302541-INQUIRE | MyBiosource | INQUIRE | Ask for price |
Recombinant Mouse Zinc finger protein ZXDC (Zxdc) , partial |
|||
MBS1423505-INQUIRE | MyBiosource | INQUIRE | Ask for price |
ZXDC cDNA Clone |
|||
MBS1275350-001mgPlasmid02mLGlycerolStock | MyBiosource | 0.01mgPlasmid+0.2mLGlycerol-Stock | 200 EUR |
ZXDC cDNA Clone |
|||
MBS1275350-5x001mgPlasmid5x02mLGlycerolStock | MyBiosource | 5x0.01mgPlasmid+5x0.2mLGlycerol-Stock | 855 EUR |
Mouse ZXDC siRNA |
|||
abx941262-150g | Abbexa | 150 µg | 450 EUR |
Mouse ZXDC siRNA |
|||
abx941262-300g | Abbexa | 300 µg | 612.5 EUR |
Human ZXDC siRNA |
|||
abx941263-150g | Abbexa | 150 µg | 450 EUR |
Human ZXDC siRNA |
|||
abx941263-300g | Abbexa | 300 µg | 612.5 EUR |
ZXDC siRNA (Mouse) |
|||
MBS828452-15nmol | MyBiosource | 15nmol | 405 EUR |
ZXDC siRNA (Mouse) |
|||
MBS828452-30nmol | MyBiosource | 30nmol | 565 EUR |
ZXDC siRNA (Mouse) |
|||
MBS828452-5x30nmol | MyBiosource | 5x30nmol | 2450 EUR |
ZXDC siRNA (Human) |
|||
MBS8226946-15nmol | MyBiosource | 15nmol | 405 EUR |
ZXDC siRNA (Human) |
|||
MBS8226946-30nmol | MyBiosource | 30nmol | 565 EUR |
ZXDC siRNA (Human) |
|||
MBS8226946-5x30nmol | MyBiosource | 5x30nmol | 2450 EUR |
anti- ZXDC antibody |
|||
FNab09763 | FN Test | 100µg | 702 EUR |
ZXDC cloning plasmid |
|||
CSB-CL648494HU-10ug | Cusabio | 10ug | 279.6 EUR |
ZXDC Blocking Peptide |
|||
33R-6761 | Fitzgerald | 100 ug | 119 EUR |
ZXDC Polyclonal Antibody |
|||
A64870 | EpiGentek |
|
|
ZXDC Polyclonal Antibody |
|||
MBS9235812-01mL | MyBiosource | 0.1mL | 415 EUR |
ZXDC Polyclonal Antibody |
|||
MBS9235812-5x01mL | MyBiosource | 5x0.1mL | 1841 EUR |
ZXDC ELISA KIT|Human |
|||
EF004534 | Lifescience Market | 96 Tests | 826.8 EUR |
ZXDC (untagged)-Human ZXD family zinc finger C (ZXDC), transcript variant 2 |
|||
SC311148 | Origene Technologies GmbH | 10 µg | Ask for price |
ZXDC (untagged)-Human ZXD family zinc finger C (ZXDC), transcript variant 1 |
|||
SC318335 | Origene Technologies GmbH | 10 µg | Ask for price |
ZXDC (untagged)-Human ZXD family zinc finger C (ZXDC), transcript variant 1 |
|||
SC110802 | Origene Technologies GmbH | 10 µg | Ask for price |
Mouse ZXDC shRNA Plasmid |
|||
20-abx979021 | Abbexa |
|
|
Human ZXDC shRNA Plasmid |
|||
20-abx962371 | Abbexa |
|
|
ZXDC antibody - middle region |
|||
MBS3209941-01mL | MyBiosource | 0.1mL | 455 EUR |
ZXDC antibody - middle region |
|||
MBS3209941-5x01mL | MyBiosource | 5x0.1mL | 1995 EUR |
ZXDC Antibody, HRP conjugated |
|||
1-CSB-PA648494LB01HU | Cusabio |
|
|
ZXDC Antibody; HRP conjugated |
|||
MBS7001850-005mg | MyBiosource | 0.05mg | 190 EUR |
ZXDC Antibody; HRP conjugated |
|||
MBS7001850-01mg | MyBiosource | 0.1mg | 270 EUR |
ZXDC Antibody; HRP conjugated |
|||
MBS7001850-5x01mg | MyBiosource | 5x0.1mg | 1205 EUR |
Zxdc (GFP-tagged) - Mouse ZXD family zinc finger C (Zxdc), transcript variant 1 |
|||
MG210478 | Origene Technologies GmbH | 10 µg | Ask for price |
ZXDC (GFP-tagged) - Human ZXD family zinc finger C (ZXDC), transcript variant 2 |
|||
RG217502 | Origene Technologies GmbH | 10 µg | Ask for price |
ZXDC (GFP-tagged) - Human ZXD family zinc finger C (ZXDC), transcript variant 1 |
|||
RG218266 | Origene Technologies GmbH | 10 µg | Ask for price |
Zxdc (untagged) - Mouse ZXD family zinc finger C (Zxdc), transcript variant 1, (10ug) |
|||
MC200020 | Origene Technologies GmbH | 10 µg | Ask for price |
AAP50448-100UG - ZXDC Peptide |
|||
AAP50448-100UG | Aviva Systems Biology | 100ug | 99 EUR |
ZXDC Antibody, FITC conjugated |
|||
1-CSB-PA648494LC01HU | Cusabio |
|
|
ZXDC Antibody; FITC conjugated |
|||
MBS7004484-005mg | MyBiosource | 0.05mg | 190 EUR |
ZXDC Antibody; FITC conjugated |
|||
MBS7004484-01mg | MyBiosource | 0.1mg | 270 EUR |
ZXDC Antibody; FITC conjugated |
|||
MBS7004484-5x01mg | MyBiosource | 5x0.1mg | 1205 EUR |
Recombinant Human ZXDC Protein |
|||
E30P03222A | EnoGene | 50 ug | 295 EUR |
ZXDC Antibody, Biotin conjugated |
|||
1-CSB-PA648494LD01HU | Cusabio |
|
|
ZXDC Antibody; Biotin conjugated |
|||
MBS7000409-005mg | MyBiosource | 0.05mg | 190 EUR |
ZXDC Antibody; Biotin conjugated |
|||
MBS7000409-01mg | MyBiosource | 0.1mg | 270 EUR |
ZXDC Antibody; Biotin conjugated |
|||
MBS7000409-5x01mg | MyBiosource | 5x0.1mg | 1205 EUR |
Zxdc (Myc-DDK-tagged) - Mouse ZXD family zinc finger C (Zxdc), transcript variant 2 |
|||
MR224935 | Origene Technologies GmbH | 10 µg | Ask for price |
Zxdc (GFP-tagged) - Mouse ZXD family zinc finger C (Zxdc) transcript variant 2, (10ug) |
|||
MG224935 | Origene Technologies GmbH | 10 µg | Ask for price |
Zxdc (Myc-DDK-tagged) - Mouse ZXD family zinc finger C (Zxdc), transcript variant 1 |
|||
MR210478 | Origene Technologies GmbH | 10 µg | Ask for price |
ZXDC (Myc-DDK-tagged)-Human ZXD family zinc finger C (ZXDC), transcript variant 2 |
|||
RC217502 | Origene Technologies GmbH | 10 µg | Ask for price |
ZXDC (Myc-DDK-tagged)-Human ZXD family zinc finger C (ZXDC), transcript variant 1 |
|||
RC218266 | Origene Technologies GmbH | 10 µg | Ask for price |
ZXDC ORF Vector (Human) (pORF) |
|||
ORF012111 | ABM | 1.0 ug DNA | 114 EUR |
Zxdc ORF Vector (Mouse) (pORF) |
|||
ORF062801 | ABM | 1.0 ug DNA | 607.2 EUR |
Zxdc ORF Vector (Mouse) (pORF) |
|||
ORF062802 | ABM | 1.0 ug DNA | 607.2 EUR |
Human ZXDC knockout cell line |
|||
ABC-KH17908 | AcceGen | 1 vial | Ask for price |
Human ZXDC knockdown cell line |
|||
ABC-KD17908 | AcceGen | 1 vial | Ask for price |
ZXDC Peptide - N-terminal region |
|||
MBS3245516-01mg | MyBiosource | 0.1mg | 180 EUR |
ZXDC Peptide - N-terminal region |
|||
MBS3245516-5x01mg | MyBiosource | 5x0.1mg | 730 EUR |
ZXDC Antibody - N-terminal region |
|||
MBS3220714-01mL | MyBiosource | 0.1mL | 455 EUR |
ZXDC Antibody - N-terminal region |
|||
MBS3220714-5x01mL | MyBiosource | 5x0.1mL | 1995 EUR |
Recombinant Human ZXDC, His-tagged |
|||
ZXDC-3888H | Creative BioMart | 25ug | 255.2 EUR |
ZXDC Polyclonal Antibody, HRP Conjugated |
|||
A64871 | EpiGentek |
|
|
ZXDC Polyclonal Antibody, FITC Conjugated |
|||
A64872 | EpiGentek |
|
|
ZXDC Polyclonal Antibody, Biotin Conjugated |
|||
A64873 | EpiGentek |
|
|
Lenti ORF clone of Zxdc (mGFP-tagged) - Mouse ZXD family zinc finger C (Zxdc), transcript variant 2 |
|||
MR224935L4 | Origene Technologies GmbH | 10 µg | Ask for price |
Lenti ORF clone of Zxdc (mGFP-tagged) - Mouse ZXD family zinc finger C (Zxdc), transcript variant 1 |
|||
MR210478L4 | Origene Technologies GmbH | 10 µg | Ask for price |
Lenti-ORF clone of ZXDC (mGFP-tagged)-Human ZXD family zinc finger C (ZXDC), transcript variant 2 |
|||
RC217502L4 | Origene Technologies GmbH | 10 µg | Ask for price |
Zxdc sgRNA CRISPR Lentivector set (Mouse) |
|||
K4081401 | ABM | 3 x 1.0 ug | 406.8 EUR |
ZXDC sgRNA CRISPR Lentivector set (Human) |
|||
K2744201 | ABM | 3 x 1.0 ug | 406.8 EUR |
Zxdc 3'UTR GFP Stable Cell Line |
|||
TU173056 | ABM | 1.0 ml | Ask for price |
ZXDC 3'UTR GFP Stable Cell Line |
|||
TU079581 | ABM | 1.0 ml | 2799.6 EUR |
Zxdc 3'UTR GFP Stable Cell Line |
|||
TU273955 | ABM | 1.0 ml | Ask for price |
ZXD Family Zinc Finger C (ZXDC) Antibody |
|||
abx036152-100g | Abbexa | 100 µg | 337.5 EUR |
ZXD Family Zinc Finger C (ZXDC) Antibody |
|||
abx036152-100ug | Abbexa | 100 ug | 469.2 EUR |
ZXD Family Zinc Finger C (ZXDC) Antibody |
|||
abx307154-100g | Abbexa | 100 µg | 362.5 EUR |
ZXD Family Zinc Finger C (ZXDC) Antibody |
|||
20-abx307154 | Abbexa |
|
|
ZXD Family Zinc Finger C (ZXDC) Antibody |
|||
abx307154-20g | Abbexa | 20 µg | 162.5 EUR |
ZXD Family Zinc Finger C (ZXDC) Antibody |
|||
abx307154-50g | Abbexa | 50 µg | 250 EUR |
ZXD Family Zinc Finger C (ZXDC) Antibody |
|||
abx239763-100l | Abbexa | 100 µl | Ask for price |
ZXD Family Zinc Finger C (ZXDC) Antibody |
|||
abx239763-100ug | Abbexa | 100 ug | 661.2 EUR |
ZXD Family Zinc Finger C (ZXDC) Antibody |
|||
abx239763-50l | Abbexa | 50 µl | 350 EUR |
Paraffin Wax | |||
P191410 | |||
Paraffin wax pellets | |||
GRM10702-2KG | |||
Paraffin wax pellets | |||
GRM10702-500G | |||
Paraffin wax Pellets | |||
GRM10702W-2KG | |||
Paraffin wax Pellets | |||
GRM10702W-500G |